DPCstruct | MC3404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1PWV5 | 1-109 | MAEHLSKSAVAGLPVTEYSVLRAGLRTGDLLFASGDYLVSQAIQKVTKSPWSHIGIIFKIEEIDRVLLLESVEDMGVRFVPLSKYTD… |
| A0A366GW09 | 1-109 | MLLDWLSRRLAAYLSKQIKCHSVRTSSWEAMQCSVRPGDVLLVEGKSRISKAIKYLTQSTWSHAALYLGPNAALGMTEDGEPHVLVE… |
| A0A2H0QEZ8 | 1-106 | None |
| A0A2V7XG60 | 2-123 | None |
| B9Z0K0 | 2-112 | None |
| A0A832F187 | 3-88 | None |
| A0A3D0I6K5 | 80-196 | None |
| A0A4Y3W9E3 | 4-115 | None |
| A0A3D9ILU8 | 2-120 | None |
| A0A2N2FGA1 | 7-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.