DPCstruct | MC34037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 255 ± 45 aa |
| Standard deviation of domain lengths | 44.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817GV50 | 1-275 | MIREKITDFLTYACWPSKVRKLVTGLVRAIIMGDPVETLKYLLPKTCESINKIMNDPEGNALLTDHKGDKELTWYLVLFSELVRVRG… |
| A0A6H5I1W4 | 3-198 | ALNKLRNFVMEYELEIQVAGPLVAVICRMFSNTHAKETLNALMPFLVDKVLEILGDGDDVIKAEAVDHQLLYPLLLLKSLSLVHCDV… |
| A0A819LJJ1 | 358-656 | None |
| A0A817WIH5 | 2-199 | None |
| I1N058 | 587-843 | None |
| A0A817SSK3 | 178-459 | None |
| A0A3P6R0Z2 | 8-174 | None |
| A0A819N5H1 | 2-258 | None |
| C1GVY2 | 1197-1512 | None |
| A0A820U4T1 | 2-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.