DPCstruct | MC34034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 113 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.18 |
| Pfam Score | 91.88 |
| Assigned Pfam label(s) | CL0041- PF17217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3ZRG8 | 2-88 | YCRLPPHIRHQLCLLLDPPNARGNDWRMLAQALTVDRYIIFFATKPSPTENILDLWEARHREETAVTDLMNILRVMGRMDAASVLEK |
| A0A2G9TGF6 | 33-138 | SIYDKPPAEEDRVVTTDFNLPVEVKDELSQLLDPPTDPDRDWRGLAKKLHTDRYIQYFATRPGCSPTTLLLDLWEARECGSLRAAHD… |
| A0A3M6URD2 | 236-350 | None |
| A0A0P4W7Z4 | 28-189 | None |
| A0A6P4YAQ7 | 525-684 | None |
| A0A815P5R4 | 362-491 | None |
| A0A6I9YZ37 | 569-653 | None |
| A0A6I8P9B5 | 397-489 | None |
| A0A817RIP2 | 1-108 | None |
| A0A2T7PG64 | 440-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.