DPCstruct | MC34033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 481 ± 61 aa |
| Standard deviation of domain lengths | 61.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817IQP1 | 2-454 | LQSISAKIQAVIAELTSQELINKDTKEFSQQRDQFYNKLNEKLLILDEAKVLSKYAFGFNVNEAIEECFKSIAIKATDIHTNINKFL… |
| A0A817FHK8 | 6-446 | NKGKEYVRQQTQEISMKIKDSLKEYKIKEALDNIETLYAYKVELDKVVNIKQSCEQVRSKVTEIFQEAYQLINEDKNEIGKHRDERY… |
| A9VEF2 | 85-573 | None |
| A0A821GL75 | 2-573 | None |
| A0A820QCW8 | 1-544 | None |
| A0A817P9L9 | 1-446 | None |
| A0A821B2K1 | 2-456 | None |
| A0A0K8SWL7 | 470-1031 | None |
| A0A821C0G8 | 3-454 | None |
| A0A822A3H5 | 332-851 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.