DPCstruct | MC34032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 765 |
|---|---|
| Mean domain length (aa) | 313 ± 72 aa |
| Standard deviation of domain lengths | 71.58 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | CL0023- PF16540- CL0108- PF16183- PF08740 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817FBQ1 | 5-347 | SIKVAVRVRPFSQREKDRSAKLVIKMQGKSTFITDPKAPRFNCTLFAYGQTGSGKSYSMIGYGVNRGIIPIVCNELFREMQKKKVSS… |
| A0A7G2C1S1 | 297-583 | TKSYDDNIHTVVINNSKNPKVVAADGKVQVDGKSFKVTETQTDNSPFDLSKSDYLTHLTEQSHEGRVTSVISLCGDNNKANVDLSEK… |
| A0A7J0FR92 | 78-356 | None |
| C3ZIA2 | 34-435 | None |
| A0A5J5V9G9 | 5-334 | None |
| A0A1Q9CJW1 | 262-607 | None |
| A0A673WCH8 | 323-697 | None |
| A0A7S2SUA8 | 546-997 | None |
| A0A287WXS1 | 2-237 | None |
| E7F2U4 | 32-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.