DPCstruct | MC3403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6EGK4 | 19-148 | MINPNELRIGNYYIDLNGNPTIWEFGRHDWDYFTPEELEAISPVPITDDWLEKFGFIEMEDTVPEGYPTFRPPMGRSRIYYTDTTEM… |
| A0A3R6AC93 | 6-116 | IIGDIVMYKNRIHTIIDILASYGYELSYVRHPVSPVRLSRVPLTTEILEKNGWKNLYEKFFEKNVNDIRLTIEFSENIYVAINRIFI… |
| A0A378RT35 | 1-149 | None |
| A0A4Q0ME55 | 1-114 | None |
| A0A3S4UVL5 | 1-112 | None |
| A0A7C6FJ80 | 1-144 | None |
| A0A316R4Z9 | 17-141 | None |
| A0A2D8LFK7 | 1-142 | None |
| A0A327VT17 | 3-116 | None |
| A0A4R8I5X2 | 55-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.