DPCstruct | MC34029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 139 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0052- PF01814 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6NT71 | 6-129 | LDAMNEVHKEEVVLINRLGELVVQGIEGAPDLDLIGRSVDGWVVHTRDHFDGENRLMERYGFPPYPVHKAEHAQVLARLESIQAQWI… |
| A0A7W7Y2X3 | 371-517 | ERAQRPLPALKSGTSGSFIEWNDGLTIGVKRFDDQHRKLVDIINRLADAAKKGEGKRVLGPIFDELLNYTVTHFSEEQEAMERHGYP… |
| A0A1V5ZKJ1 | 141-285 | None |
| A0A7Y3JGL7 | 473-605 | None |
| A0A850KE93 | 558-693 | None |
| A0A850KI01 | 2-146 | None |
| A0A349MG34 | 8-153 | None |
| A0A349MGH1 | 8-151 | None |
| A0A349MKP5 | 499-641 | None |
| A0A2N1R5V1 | 325-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.