DPCstruct | MC34022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497HX91 | 53-156 | IALCPEHHNMADIGIYTKEQLRYFKKHPYVQDKLKVKWPWDPEKIVFRMGGSILFGSRAALTLESNKILEVKKKFIPSLNRATFSFN… |
| G4FAK9 | 1-102 | MIALCREHHIQADNGAFTKVQLHDFKKNGKENWSQVRGKFNWMRNRLLAVVGSNFYYETPVIFEFKEQPIIWFERDENDYLLLNLHM… |
| A0A1P8U7I4 | 1-97 | None |
| A0A4R2GKS0 | 52-153 | None |
| A0A509E163 | 51-146 | None |
| L0DG97 | 59-157 | None |
| A0A356ES25 | 1-106 | None |
| A0A4R2FG88 | 1-115 | None |
| A0A660WFK2 | 1-101 | None |
| A0A1Q3T8E2 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.