DPCstruct | MC34018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 149 ± 27 aa |
| Standard deviation of domain lengths | 27.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662Y0T2 | 7-154 | LKAYRYDPYPKVLTIEKYDLPQMMKIRRAAIDQSKSAKKFGIVLGTLGRQGNPTVLDRVKKLLEKSGKEYFVLLLSELFPDKLARFS… |
| A0A831NWE1 | 65-193 | GVRVFVADPYREEVRDLSGLVRRTLAVRWYAISKLRDAGRVGIVVGLKTGQAFMEQALKLKKRLEEKSKKVYLFALREVVPEALVAF… |
| A0A6V7PJ79 | 3-148 | None |
| A0A1E7FZP2 | 256-421 | None |
| A0A6P5N346 | 27-205 | None |
| A0A1V4YTA6 | 35-159 | None |
| A0A383WIQ3 | 272-471 | None |
| A0A835IQR1 | 5-179 | None |
| A0A6A2Y8V0 | 79-187 | None |
| A0A075FRQ7 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.