DPCstruct | MC34017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.98 |
| Pfam Score | 97.58 |
| Assigned Pfam label(s) | CL0092- CL0202- CL0236- PF01781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662XZ88 | 41-107 | VQPKQITDIRDFLQKARRKDARSVKIKKSDKVVKFKIRCSKYLYTLCVTDTEKADKLTQSLPPGTCR |
| A0A1C3KCT5 | 1-77 | MPKQITDIRKFLKISRKPDTTAVIIVKKKSRTKKNTIITKLKLRTKRYLYTMVFSDRKKAERIENSLQPRLKRIYYP |
| A0A803KTJ6 | 69-134 | None |
| A0A830CBF2 | 1-52 | None |
| A0A4S8IQF2 | 20-85 | None |
| A0A0D3BPJ8 | 361-427 | None |
| A0A4Y1QPA6 | 2-63 | None |
| A0A4Y1QP30 | 84-159 | None |
| A0A2K1J110 | 26-73 | None |
| A0A1I8FUL3 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.