DPCstruct | MC34016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 195 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0SJW3 | 30-225 | GSTPLGSDAIQAVALLFAITLLPVLVRVRIHYTFCWVGFTVLAHVTESEAALGLATSMGLTIMMGWYSLRALDRTTFMGILQGWFGF… |
| A0A662XWS9 | 28-202 | MDAAVAVLLLFFVVALPPFVGVRTMYTNCWVAYTIVAHLLASEAALGIATSMGITIMVGWYTLRVFDRYAFTAILNGWLGVWASSPV… |
| A0A6A3NY23 | 401-596 | None |
| A0A024U9W5 | 9-175 | None |
| A0A3F2RLI6 | 2-195 | None |
| A0A0N7L8C0 | 7-220 | None |
| A0A3F2RLP4 | 1-173 | None |
| K3W6U0 | 397-613 | None |
| H3GJA6 | 231-447 | None |
| A0A3R7HAG4 | 186-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.