DPCstruct | MC34014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 228 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DNG3 | 48-287 | GMYSEWASLSALIQNGCDESQSVLGKLPMSAGREVALSVVKQLASNLGIVQPAESSPLDSDRDVQWCMEVICFGLSLPLSEHDTIRD… |
| A0A662XKI0 | 3-211 | SMVVGFLGADGVDPVAVLPSGHHIRWAMEVLGHAFALPMEDADVIAGSLRIYERWLGVDDASLVAKGGKGGKDQRPACMQKVEQTFI… |
| A0A4U5TV08 | 4-224 | None |
| A0A044QT72 | 19-257 | None |
| A0A6V7WRC4 | 5-253 | None |
| A0A813SGE4 | 16-269 | None |
| U9UIN7 | 4-263 | None |
| A0A286Y9P2 | 12-231 | None |
| A0A132AL75 | 1-255 | None |
| A0A815SA26 | 220-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.