DPCstruct | MC34013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 162 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF01264- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1P2U0 | 183-318 | KSITEASPVRCLDEEAGNQMIKAIDDAKSNGDSIGGIVEVIVEGMPIGVGSYVHYDRKLDAKLAAAMMSINAFKGVEIGIGFEAAHR… |
| A0A662XIX3 | 188-356 | DSTGGVVTCVIRNVPVGLGEPCFDKMQAVLAHAMLSIPATKGFEIGSGFSGTSKRGSEHNDPFCAGTDASRPAKLGVTKNDAGGVLG… |
| A0A395IW04 | 110-284 | None |
| A0A7C6ZGR9 | 171-356 | None |
| A0A1V6F242 | 363-525 | None |
| A0A7S1PCY3 | 26-197 | None |
| A0A4S4EBH6 | 201-394 | None |
| A0A5A7QUA9 | 236-489 | None |
| C4KWI2 | 288-446 | None |
| A0A0M8MMP9 | 679-857 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.