DPCstruct | MC3401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 179 ± 30 aa |
| Standard deviation of domain lengths | 30.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3MM21 | 176-360 | IAGGLLGVLLSGNARKLVGTGFKVGGAALIGGLAYKAYEDWKAGKSAAAARPDEPLALPEPSPDFLPTDAVAANDLAERLVQAMVAA… |
| A0A541CGQ4 | 10-154 | ALAAQVERAAAQHVLTTTAEEGHDGAIMPHSPAATDHALRLVRAMIAATKADGKLTDDERERLLDRIGPAQFDPDVQDWLQREFRAP… |
| A0A5S9PHI3 | 228-465 | None |
| A0A502HLR8 | 55-234 | None |
| A0A840UVZ8 | 51-194 | None |
| A0A0N8GFF5 | 106-247 | None |
| A0A2T4Z388 | 74-319 | None |
| A0A840YRH7 | 1-191 | None |
| A0A4Q3PKG7 | 33-191 | None |
| Q28RE5 | 47-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.