DPCstruct | MC34009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 358 ± 35 aa |
| Standard deviation of domain lengths | 34.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1P667 | 11-375 | LVPEPSATTDRSYMSVVYSALCSDSWNSYLSAWNGVTNHTTTQSRRFSPWTVDGSTQGQINGSWVQKIVMIDVSNKFNGRIVNNVPL… |
| A0A7C8I6A4 | 417-785 | PIRSDKAERGSTCLQISHAAQGYHNYRTYLSSWSIEANRGNGTSDQNGRPPGFGLLHDNTTVTAKWINPIDTTKMSKEHGRAINNVS… |
| A0A4U0XTA6 | 171-517 | None |
| A0A167ZIS4 | 30-414 | None |
| E5A4K7 | 23-380 | None |
| A0A218YWH8 | 1-277 | None |
| K9FUD7 | 1-393 | None |
| A0A5M9M481 | 30-425 | None |
| B2WIC9 | 191-529 | None |
| A0A436ZPX2 | 1-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.