DPCstruct | MC34003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 191 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1MRV7 | 1-185 | AAALWAVAGVGLGLYWLPLLHLDDADLDRMGGLGLVSVLPRATLLGAALLIVAFAGALWLARPRPALLTAVLLATVVSLHAVPAVLE… |
| A0A6F8YFC2 | 134-336 | GLGAVAVALSLWWVATRQVDAGAAGAVGLVAVAPPAYWLALLVLAGVLAWALLRPVLDHVVLAAGCLAAVVCCYLLVNVADAAAGPG… |
| A0A842QAZ5 | 4-184 | None |
| A0A535SI07 | 556-736 | None |
| A0A401ZXZ2 | 173-384 | None |
| A0A838E8V2 | 499-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.