DPCstruct | MC34001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9D240 | 11-151 | MFFTAWRLLFVLLSFCIGLFLAIWGGKLLSLGGSAWYLLAGLAYMVIAVGYLIRSKYVLPFAIITFFLTLVWALYEVQLSYWGLIPR… |
| A0A2D7XV68 | 2-145 | ISRVLNWLFAAFLLSVGLYLTIRGWTLVSLGGSWYYVLAGLGLLGVVALLMLRNGAAGMLYAVITFATLVWSIPEAGIDLLALLPRL… |
| A0A3M6C6M2 | 1-149 | None |
| A0A4P1B195 | 1-160 | None |
| A0A3N9U6D8 | 7-155 | None |
| A0A0P9THQ7 | 1-94 | None |
| A0A2K4L6F5 | 28-162 | None |
| A0A0B4XKW3 | 14-119 | None |
| A0A1E3H6A5 | 10-154 | None |
| A0A7H4PA28 | 13-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.