DPCstruct | MC340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8SH55 | 3-77 | SAINWREMFADLSQLGLAPRGVVRELRSVISLTAVRKYIEGETEPSHVRGELILDLWCEKTGKRREDAPRLAKYK |
| A0A2I8Y767 | 1-87 | MPVVVSYRYDWFRIIEDISREGLTLSDIAKELDVSKTAVIGWKQGAEPRYFAGDALISLWCHIKQRRKEDLPTQILSRKFIHNYTSR |
| W1EQ20 | 2-73 | None |
| A0A809NAV0 | 28-112 | None |
| A0A0U2U370 | 1-75 | None |
| A0A5E4VDY7 | 5-78 | None |
| A0A085AE70 | 1-77 | None |
| A0A1P9XU21 | 1-84 | None |
| A0A556RGH3 | 4-76 | None |
| A0A096F7F2 | 21-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.