DPCstruct | MC34
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2FTF9 | 1-117 | MTASSIQVQFVQAMTARGWRPDRVRVDVAFKDYDTAAGGRTAVVYCRQNSDGDHVLTGDYWSEGRNALSTCWALFRPGTDKATIAAE… |
| A0A853SSP5 | 1-125 | MQDQSSTNYEIDPCLYKVIMENLAHAGWSILKGGTAVAKKDFQTAVGQKEALVYLAPWGPAEPNCVLQGQYYSEGRNILEASSMLIP… |
| V7D8C1 | 6-130 | None |
| A0A3N8CK95 | 54-168 | None |
| A2SNF2 | 2-110 | None |
| A0A1Q8Y985 | 1-111 | None |
| A0A291IQK0 | 5-113 | None |
| A0A2V4Q3L5 | 85-211 | None |
| A0A226X5K7 | 2-104 | None |
| A0A5H2YI49 | 9-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.