DPCstruct | MC33998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6ZVD4 | 34-125 | PSAAAMDAVLHSERMERGRKRIHPLPGPLSELADGTIIAASGFAYTIASGRAFRWTEHGYEPSQKLAHAEGMLTPPSTFMALRGGYR… |
| Q0S409 | 162-249 | ADQMDARLHGERLVGSGQRTHEAPWSSLPDGAFALSDGGPAVVLGDTVVPWSAEGYGTPANRPTGTATVLTPPSTVAVLTAGYRPDVA |
| A0A1F4ADS1 | 65-160 | None |
| A0A1Q8Y1M5 | 108-203 | None |
| A0A7Y5W2G8 | 40-150 | None |
| A0A7G2M2Z9 | 3-93 | None |
| A0A4V2YNK2 | 105-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.