DPCstruct | MC33991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 259 ± 37 aa |
| Standard deviation of domain lengths | 36.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 14.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6NQK0 | 3-283 | KISWRDIPQEVANILYNLPLRQYSDPFFDGQRYHVFQVVEFEKEVLLRESDFQANRQSLNGIIRQRKEQKLSAGYVQKIMTPQNVII… |
| A0A7V5LKI2 | 65-341 | QGVLSNYLTPGMAAPEYEEAAYSLWQVGQISQPVKTDFGYHIIRLMYREKLKVGSIEEEKARLEQIAQQAARTQFLRDYINSLFQKF… |
| A0A7R9N4V1 | 61-272 | None |
| A0A833AN48 | 2-239 | None |
| A0A7J5F0P5 | 30-347 | None |
| A0A2D7MFN0 | 105-399 | None |
| K1KUN3 | 103-318 | None |
| A0A7C2WRV5 | 15-309 | None |
| A0A0B5FE10 | 299-513 | None |
| A0A124IKJ9 | 184-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.