DPCstruct | MC33987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3313 |
|---|---|
| Mean domain length (aa) | 192 ± 35 aa |
| Standard deviation of domain lengths | 34.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.59 |
| Pfam Score | 95.88 |
| Assigned Pfam label(s) | CL0020- CL0194- PF16178- CL0219- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K2IWG7 | 3-161 | KQKILVIDLETTGLDPFTDYIVSIAISVEKGKGFNIVLPFYKNKAKAKEFLQPILPLLEDETITKVFHNAKFDLKFFHQYCIEIKGE… |
| A0A093IHA8 | 1-128 | MTGLDVEKDQILEMACLITDSDLNVLAEGPNLIINQPDELLESMSEWCKEHHGKSGLTKAVKESKISLQQAEYEFLSFVRQQTPPGL… |
| A0A0P1AWU1 | 52-267 | None |
| A0A3D3P143 | 196-354 | None |
| A0A0P1B1C8 | 888-1105 | None |
| A0A1L9TKP6 | 5-171 | None |
| A0A6I6L5I5 | 32-234 | None |
| A0A6G1IN35 | 13-136 | None |
| F6H7B6 | 6-177 | None |
| A0A5N6E5P2 | 53-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.