DPCstruct | MC33985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF05183- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484ND19 | 218-330 | LVPIMYPPQGVVLPFKLLFRICALVQHGCLPGPLLNADFFHLVDPQWRDINCIEYALAKMFSLHECCYDPVQWLTQEYEKFKYSPVS… |
| A0A3P6F4U5 | 5-132 | FSYSSNTNSLSPVVDPPPEFDLPFEILFNVNSLVQNACLPPTSLDTEFYQFLDPKTHDRAFIDYALPKLLCLGKCSYEHVAWLAKES… |
| A0A6A6MGX2 | 597-712 | None |
| A0A6A6LZU2 | 85-211 | None |
| A0A6S7M8P4 | 258-368 | None |
| A0A3L6RGD7 | 37-151 | None |
| A0A5C7IQ94 | 240-352 | None |
| A0A3L6QE55 | 567-695 | None |
| A0A6V7P7T0 | 313-429 | None |
| A0A2Z6MU58 | 278-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.