DPCstruct | MC33982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098LSG0 | 1-103 | MDLSFQPELEQYNITYKDANGKPIDLLPFVAENGTNLIRLKLWHTPKDGQNSLNDVKAYAKRVKAQNMDFLLNFHYSDYWADPGKQN… |
| A0A3R5WJ32 | 217-347 | SFIEGVDVSSYVSLKNSGVKYYDFDGNELDDIGYFKFLASCGINYVRVRVWNDPYDSEGNGYGGGDNDLETAKKIGQYATAAGMKLL… |
| A0A4S9NT96 | 515-644 | None |
| A0A6V8HGU7 | 318-446 | None |
| W2JPT1 | 2-78 | None |
| A0A4Q4ZW60 | 13-137 | None |
| A0A6S7CE69 | 1-126 | None |
| A0A844FQH2 | 151-266 | None |
| A0A1V8Q5U0 | 537-646 | None |
| A0A6M0IBE4 | 917-1052 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.