DPCstruct | MC3398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 148 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4SFD5 | 1-116 | MVSLLQQLIQDAWQNAAFEGISMDCLGLASIQATQSGLIEVNGEKIPALRGDRLSDGQPLTIYPGEVPARLPGQAFWQQQGFQFENF… |
| A0A850NXQ6 | 13-151 | SGAGPAGGIGRVAWAATKADHVARAQRGNLAALIGRLTESGHSTGARITEAHFAIASIRCTEDFVWSLDGRPVSAVRGRLLGEDTLT… |
| A0A257YHY1 | 125-284 | None |
| A7C081 | 36-184 | None |
| A0A258K2L7 | 2-137 | None |
| A0A037UXR5 | 152-319 | None |
| A0A3M1HN97 | 273-484 | None |
| A0A378C9H0 | 61-209 | None |
| A0A378N563 | 71-202 | None |
| A0A7C5N2G9 | 245-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.