DPCstruct | MC33977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 239 ± 28 aa |
| Standard deviation of domain lengths | 27.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090VR30 | 1-247 | MKFKYISLFALLIGFLSCEEVESPIPEAEVLPELTSGSADFSNYVALGASFTSGFTDGALFKASQENSFPNILSQQFAKVGGGNFTQ… |
| A0A321LRP7 | 1-192 | MVLGEGLAAGVGDFTLTAETQMWSFPAQMARQMGADLPTHFIQAPGLGDFPGFQRLSVRIPAPLQTTVLSELPPKRVANLSVPGFRV… |
| A0A432I6M5 | 1-245 | None |
| A0A2E4FER3 | 107-333 | None |
| A0A1V1PGU4 | 26-243 | None |
| A0A2D4ZVU3 | 19-240 | None |
| A0A2T2UPN9 | 30-239 | None |
| F0RPM4 | 49-267 | None |
| A0A534TCY6 | 14-252 | None |
| A0A553GFE8 | 7-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.