DPCstruct | MC33974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815X403 | 3-143 | VDDTNQGLQHIPGADDTTLLSNVSDEFVLPPISTTAQTPAARQAAKRKRKLIVDEVKEIDSGAMKTQLSDTTDIVGVLELAPPTRRL… |
| A0A0N4XTA2 | 1-124 | MHGDHTAAENNDDLQLGAAANNLGGEIPESFTLEPLEAGALDRQQERRRRRRRLIIDDQKNIGGEEMKANMADYSDTLQPLDLAPPT… |
| A0A5B7DI68 | 258-430 | None |
| A0A448X9A1 | 15-177 | None |
| S4RFP5 | 28-209 | None |
| A0A444TIJ3 | 272-444 | None |
| A0A3S2N0B3 | 195-371 | None |
| A0A1D2MSP4 | 281-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.