DPCstruct | MC33970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2D1L4 | 1-85 | MDSNVRVDFTHHLKTLNFLRKKIQKIVTSKVNSEVPKKIIEAIEQQVNPRLQKLKEKMISMGYKEYDVEWTVQNNILRVAVKPKR |
| A0A0C2C6P8 | 44-147 | VNLDVKLVWNDFKFIPTVNMDSNVRVDFTHHLKPLKFLRKEIQKIVTSKVNSEVAKKITEAIEQQVNPRLQKLKEKMISMGYKEYDM… |
| A0A0N4VTT3 | 63-172 | None |
| A0A368FKI7 | 81-183 | None |
| A0A368F5J6 | 1-84 | None |
| A0A0B1RZ48 | 61-162 | None |
| A0A3P7K7Z3 | 66-187 | None |
| W2TCL9 | 49-151 | None |
| A0A0B1RX43 | 104-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.