DPCstruct | MC3397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 16.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B8VVM4 | 2-106 | SILAVALGGFLGGAGRLFLSRRLPAFWGTWTANMIACLILGATTSLLHSPLGLALVATGGAGALSTWSTLVRELGQLAQDGRRKAAG… |
| A0A839UZ47 | 2-129 | LLNYALVALGGALGSMLRAWGVVAVQTLTGAALPWGTIAINVIGSFVIGFFGTLTANDGRFAAPHDLRTFVMVGICGGFTTFSSFSL… |
| A0A446JY95 | 143-289 | None |
| A0A2U1JZM5 | 2-120 | None |
| A0A2V2B9E8 | 2-135 | None |
| A0A351KSL2 | 2-127 | None |
| A0A1I3WTX2 | 2-137 | None |
| A0A820P374 | 10-175 | None |
| A0A1Y3GJB2 | 59-174 | None |
| A0A7K2CRT5 | 12-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.