DPCstruct | MC33966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DDJ0 | 347-455 | LEEFAIDGRFCISIHDEVRYLVQEEDRYRAALALQIANLLTRCMFAYKLGLNDLPQSVAFFSAVDVDRCLRKEVTMDCETPSNPTGM… |
| A0A3P7J365 | 13-107 | KFQVRYLCPEEDAPRLALALMLSNMYVRSFISSKLGIEQLPLSVAFFSQVDCDRVLRKEVHLPCFNVDGTKVPDGVSWTIDDVVQIT… |
| A0A1I8ITE4 | 664-785 | None |
| H0EXW0 | 504-611 | None |
| A0A1Z5T4U4 | 524-634 | None |
| J9E058 | 157-236 | None |
| A0A0B1TFI9 | 1-95 | None |
| A0A0S7FG42 | 67-176 | None |
| A0A4Y9XPJ9 | 165-268 | None |
| U4UQB4 | 288-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.