DPCstruct | MC33965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 190 ± 45 aa |
| Standard deviation of domain lengths | 44.76 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 85.19 |
| Assigned Pfam label(s) | CL0547- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7J2T4 | 2-184 | FFTVCQVTKALTGSILRNLTGCEEIDGFIDIQDSKMKSSVNGYTRDDLNALKSVRMISEYVQIATQTVSPRNLSFLENLEFIEGRSL… |
| W2TZH3 | 148-292 | CETICSGGLVDEEYLATVRGCQVINGNLTIEGWEKPPPHLNNLRTVRRINGSLQIKNTSDLGDFYYLEELREITVPEESDAEAIEIV… |
| D1ZZZ9 | 191-334 | None |
| T1EEW8 | 179-376 | None |
| S4RA78 | 35-244 | None |
| S4RBE3 | 2-170 | None |
| S4RRI3 | 113-253 | None |
| A0A5E4QFT2 | 19-191 | None |
| A0A482WIG9 | 33-190 | None |
| A0A654H2W0 | 137-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.