DPCstruct | MC33963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 247 ± 33 aa |
| Standard deviation of domain lengths | 32.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7J0N8 | 26-233 | MCRMKPMSAERQALISAMAVTLASGQATWDPYYVTAFLHDSLGDRNWVNKPNTSFISTQIIKSLGTIYPTKDMFTSCNLEIDVDFIP… |
| A0A183U2W2 | 14-206 | CCIFSVLYSILKDSGEWPWTLVECFVDDSLHERRWVDRVCAGALVDNIITAFGTTPPNEELYTACELTYPERFQHKQVVRDRFAELA… |
| A0A6J1WXM6 | 2-202 | None |
| A0A194RM30 | 125-381 | None |
| A0A814E3U7 | 198-484 | None |
| A0A0R4IJ75 | 159-421 | None |
| F1KUS3 | 24-228 | None |
| K7H0M0 | 58-380 | None |
| A0A0K0D0Z1 | 71-298 | None |
| A0A2P8XQA9 | 67-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.