DPCstruct | MC33961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 4 aa |
| Standard deviation of domain lengths | 4.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0266- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IZP1 | 1-103 | MMGNVMGIPLRWMSEEMLQKYLMEPLKKAGLDMVSDKRIGNITCPILMMHAENDHVIPVALARKLKDAAVAAGRDVKYVEFESAKNY… |
| A0A6P6XW39 | 282-372 | FLPYFEYCFVEPLVNNPELNFNSTAQLSTIRCPLLILHAEDDVIVSFDLGRKLYEQAKMLQPKNVSEQTQFVSYPAQYGYGHQDIYR… |
| A0A2A6BZ20 | 330-422 | None |
| A0A653CYS2 | 259-355 | None |
| A0A7J7ASY8 | 238-336 | None |
| A0A1W4WUJ1 | 267-360 | None |
| W2TI88 | 113-209 | None |
| A0A834C7E4 | 186-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.