DPCstruct | MC33960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IZH0 | 2-116 | VWIRPEYLILGQPFWSTEQENQYFAIQRRKGHGTKGFSSVLVATIDSVFDTRPAPYRIIYKYENDDVQIAIVIAHAVRKNEIQEHWD… |
| A0A0K8VKU1 | 1-123 | MWIHPKEILIPPAFWVDEMRSKYFVLQKRRGHGESRSFTSLLVNTLDSVWDTKPPPYRILHQTPKSEVYYEIAIGLTQEEIVKDWEW… |
| A0A197JPW2 | 12-153 | None |
| A0A2A6BYB0 | 2-126 | None |
| Q553U1 | 4-156 | None |
| A0A1E1WJ45 | 1-123 | None |
| A0A0B2UWY0 | 1-107 | None |
| E4YB85 | 1-89 | None |
| A0A5E4C130 | 1-126 | None |
| F4Q0W8 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.