DPCstruct | MC3396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q2RXM2 | 43-121 | GEPPTAFTYHWWRHGGWYVDQTIWPNGGCGCVSRNFADKKWRIACDPRPFTEQPTFRNRDNAARGEWLYVQSLVQATPW |
| A0A2A3LEY5 | 3-80 | GEPPQAFTYEAWRHGGWYVAETVWPNGGCGCVSRNYADGKWRIACDPRPFDEQPTFRTREDAARGEWLFVKALVEATP |
| A0A3S2F3K0 | 6-79 | None |
| A0A1L5QZM6 | 9-92 | None |
| A0A2N8K9R2 | 84-165 | None |
| A0A6I6LQJ7 | 83-163 | None |
| A0A1H5A7M3 | 88-169 | None |
| A0A161XF93 | 98-170 | None |
| A0A109CZ45 | 76-151 | None |
| A0A4Q3IBE8 | 13-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.