DPCstruct | MC33959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RUU1 | 1-77 | MDLLAFEQKLDATITRKKLDIQEALKRPQKVKKRLRIYISHTFIAGKEPEKEGEEGTVPMWELRVEGRLIEDQVCLK |
| H2ZB18 | 88-164 | IQDLVPESQAYMDLLAFERKLDSTIMRKRLDIQEALKRPVKVKRKLRVFISNQFFPAKTDSDSKDEASKASWELRVE |
| A0A7J5Z4U1 | 858-944 | None |
| A0A2G8LQD9 | 95-182 | None |
| A0A4U5ME99 | 6-86 | None |
| A0A0B1TEA1 | 40-127 | None |
| A0A433QL84 | 64-168 | None |
| A0A2A2LIR1 | 133-223 | None |
| A0A6N2MS15 | 136-225 | None |
| A8XF24 | 269-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.