DPCstruct | MC33956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7Q984 | 41-120 | DDTAKCYRRFFIGREHLNLIGTDENLGPVCLSVKTENVASQEHTRILLRLKTGTMHELVPSSCLSPSPSPARMAKLLNEQ |
| A0A6G1SDS5 | 246-342 | DTGATYYRNYFYGREHQNWFGNSETYGPLAISLRKEQCRSTSRGHNNNQQVNDVKYQYRIIIRTSELAVLRGTVYEDCIPNLTQRTS… |
| A0A482WVE6 | 46-139 | None |
| A0A7M4EPC1 | 127-228 | None |
| A0A815ERN6 | 95-211 | None |
| A0A834ML63 | 867-989 | None |
| A0A6I8PSN7 | 61-160 | None |
| A0A1A9VUC7 | 83-200 | None |
| A0A3Q2UL22 | 80-164 | None |
| A0A672L925 | 450-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.