DPCstruct | MC33952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 30.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0056- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IRP3 | 13-164 | KGVRENVKQVIIIYASVYKEGHYEDARQLADQIKISGTDIIVVAFDQYGQPNALAEIKKIASPGFFFTNVQPNLAAEIQHSLCTVNC… |
| A0A3P7KEJ5 | 2-140 | AQTFIEDGGFIITVEFVQEHGSSVPLLNKLSSGPEYSFTNRYGNLTADPVRQAFCRINCFCPTNYLPYTQGDVIPSGGCYRTVPITA… |
| F1L7K1 | 103-307 | None |
| A0A3P7XCX2 | 9-123 | None |
| A0A0N4VHX3 | 132-285 | None |
| A0A0B1TTE7 | 1-160 | None |
| A0A090MW84 | 352-556 | None |
| A0A2G5UAF4 | 5-156 | None |
| A0A0K0EHI8 | 336-490 | None |
| A0A016TT66 | 130-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.