DPCstruct | MC33951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 28.11 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.05 |
| Pfam Score | 91.58 |
| Assigned Pfam label(s) | CL0020- PF12807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FK68 | 53-163 | IVRAFKHIVQSVIAATSDMRQLALTIAAVLNLLLGVPESEFSGSSPAVHPLVWRWLVAFLKKRYQYELTGQHYDDVRKYAILRGLCH… |
| A0A3P7ILY2 | 3-192 | SLSVTELIARCAKHVLRQYLNSLPQEQLGCAISHLLNAVFGNLSFDHSYGMNGDRNTKRSSKKSKKAFASGEWVAVNTKEFWSALCQ… |
| A0A2I0GBK3 | 1-153 | None |
| A0A453FK87 | 1-117 | None |
| A0A453FKA4 | 54-214 | None |
| A0A453FKA5 | 11-167 | None |
| A0A453PVL2 | 1-153 | None |
| A0A1X7TLM3 | 86-232 | None |
| A0A0K0E7J3 | 1458-1653 | None |
| E7FE02 | 1181-1371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.