DPCstruct | MC33950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 60.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7ILG5 | 1-50 | MDTYFPILTALQFVFYMGWMKVIEAVLNPFGEDDDDFETNALIDRNITVT |
| A0A3P7IVK7 | 2-43 | TMLQFIFFLGWMKVAEALLNPLGEDDDDFECNFLIDKNIAVT |
| A0A0N4X110 | 14-63 | None |
| A0A0M3JDK3 | 23-72 | None |
| A0A1I8GAX3 | 1-51 | None |
| A0A0B1SC62 | 29-82 | None |
| A0A4W5MEQ6 | 52-105 | None |
| A0A368FAR2 | 4-56 | None |
| A0A0N4VV14 | 86-135 | None |
| A0A2G5TX90 | 92-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.