DPCstruct | MC3395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18897 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014Q5P7 | 28-130 | SGGHLAAMPLEMRLRGKSTTQSHRAAIYYADLVVRTGLSLNEAIGQAKALAAQRQSAGFAQSALDEAARLGYANGSFEDAPEEAADI… |
| M4UXX8 | 1-133 | MSGNLLACLSLRLVLRGKSTAQSYRAAIYYVDLAVREGATLEATIAEARELDARRKASGFDQAALDAAAKAGFANGAFEDSPEEAAA… |
| A0A656QKY2 | 104-236 | None |
| A0A7S6YTL2 | 1-118 | None |
| A0A1E7XUA9 | 78-171 | None |
| A0A1B6NXE7 | 36-163 | None |
| N8TST5 | 36-158 | None |
| A0A238DUF3 | 72-200 | None |
| B9B2R5 | 257-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.