DPCstruct | MC33947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9DMS8 | 39-120 | HVRDVLNRKRMVAYVLLDSPEDSIMNLKEAIFKEDGSGVELEKYMDSFPFPYYVMLNNIEALPRTLADLLRQWFELMQSANE |
| A0A3P7IJG7 | 8-79 | SALQGVTVLFVILDSGPKSICDLSVASFKGGDVVLTPYLAVFPFPFYTIIKKIVQLPSVLTESIRQWFEMTV |
| A0A0P0XVA4 | 475-544 | None |
| A0A287F659 | 1087-1156 | None |
| A0A0M0K6U9 | 857-926 | None |
| A0A0D8Y9D4 | 564-643 | None |
| A0A7S4J5C4 | 37-102 | None |
| C1N1U4 | 2-73 | None |
| A0A0B1TRZ4 | 285-353 | None |
| K3X0F0 | 214-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.