DPCstruct | MC33946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7II83 | 14-91 | MKLSKTVEDLRARKAELESQTDFRLAGPGSNAARLRVCEDCGAQLNIMDHESRIADHFGGKMHLGMVECREKYAEMKV |
| A0A1E4TUS1 | 168-271 | IDAKIGLMQQELELLIDNGYISKSIEVSSSLNSLAKQRLVVVKNVRDISENLGQSSQQKLQVCEVCGAYLSRLDNDRRLADHFIGKV… |
| A0A0D0V1M8 | 127-236 | None |
| H2YST9 | 2-102 | None |
| A0A5J4X4J8 | 122-234 | None |
| G0QPI7 | 2-114 | None |
| A0A7J6ZG43 | 88-177 | None |
| S4RI13 | 210-302 | None |
| A0A4U0W2A3 | 532-654 | None |
| A0A6I8NVD8 | 187-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.