DPCstruct | MC33944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 153 ± 27 aa |
| Standard deviation of domain lengths | 26.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8Z829 | 154-287 | ILQDVDQSRKVRQSASMRRKRKDSSSDGERWGGGGTRIHSEKPRQCYGPACTRTARPGSKYCSDDCGMKLATNRIYQVLPQRLQEWA… |
| B4ILQ4 | 213-333 | QAGPSRKREKAAPKTRNVQVGPRAPSPEIYLNPELQGIRQCYGPNCCSHARPQSKYCSDKCGFNLATKRIFQVLPQRLQEWNLTPSR… |
| J9B072 | 38-185 | None |
| A0A7R9PUV7 | 178-310 | None |
| A0A164NC75 | 211-367 | None |
| A0A023GCH9 | 68-236 | None |
| A0A673WYC9 | 75-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.