DPCstruct | MC33943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IH11 | 4-95 | TAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLFLVSMEGYGTDACIYMKAVPIEASEVLPIYSTSSRRNLTMGPQVADWSHNLP… |
| A0A553QXU6 | 53-127 | VKRAGFGYGLPISRLYARYFQGDLQLYPMEGYGTDAAIQLKALSTDSVEKLPVFNKTALRNYKVNQEADDWCVPS |
| A0A095A882 | 255-338 | None |
| A0A2G9S3P2 | 136-205 | None |
| F2SBI1 | 1-102 | None |
| A0A815Y7L4 | 1-67 | None |
| A0A4Y2NWK2 | 8-104 | None |
| A0A821ZUF9 | 41-110 | None |
| A0A820J7S2 | 2-65 | None |
| A0A3S5A339 | 116-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.