DPCstruct | MC3394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078RDM3 | 2-107 | LKEKGFNEPCMIAMNIEDGRQYGTNRTNSELPIKVCSHPTQSVAQKWLRKTKNLHIEISYMYENYWTYDILTIPRHDLIGLSDRPII… |
| A0A7K3KS46 | 6-136 | IDSFVTYEQAQNLKELGYNEKGYFFFSRTFCDDGTPVIVHKGFVIPPTNEEMDDIGMENHISAPTHSQAARWLRGKKMSVEVEYNIG… |
| A0A7J0B1N8 | 1-125 | None |
| A0A1V6I3B3 | 1-132 | None |
| A0A7C6K915 | 2-116 | None |
| A0A843HDQ1 | 1-106 | None |
| A0A1M3LAI9 | 1-141 | None |
| J6IJH4 | 43-161 | None |
| A0A4Q0J667 | 1-127 | None |
| A0A250F5I8 | 3-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.