DPCstruct | MC33938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 263 ± 18 aa |
| Standard deviation of domain lengths | 17.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IPX7 | 1-283 | MEWVHSRHPSDPLCRLVLCRAYAIIGATAQLQKLMQSLDIKNVQRDTLGYLLFGLLEQYGRFNAGIIYYTELSVLFDQTEKEISECL… |
| A0A3P7I8P7 | 1-277 | MILLLEWTSNDYPTDPFCKLVLCRAYAHIGCMYRMVALTRALDIKSVQRDTLGYIMFPMPELCGRLDYLTTFIISLRFNVGIVHYTE… |
| A0A6V7WIX6 | 159-390 | None |
| A0A1Y2H8Y8 | 217-497 | None |
| A0A183H9Q4 | 82-336 | None |
| K7HAN5 | 2-250 | None |
| A0A016VN90 | 165-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.