DPCstruct | MC33932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 652 ± 163 aa |
| Standard deviation of domain lengths | 163.10 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 65.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.84 |
| Pfam Score | 87.20 |
| Assigned Pfam label(s) | PF11923- CL0684- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7H4G3 | 1-520 | MAFENNEFIISLSDPYDNETPPILVPIDISLTASKNAQRYFVDKKSAAEKVKKTVASSEKAIKNAQEKAKSTLEQVRVVVEVKKSRK… |
| A0A1J4JNB2 | 15-699 | RPPRVQQDQSGESNNEQKEGESTNQQKEGESNNEQKEGESKADEGNNAQVESKIDESQNKESERPAIPKPCGFIYAPKPKERMLCGV… |
| B8LDR3 | 404-948 | None |
| A0A7S3PJH4 | 8-609 | None |
| F2US85 | 18-922 | None |
| A0A016V9N3 | 13-1071 | None |
| A0A2A2KMW0 | 183-723 | None |
| A0A3M7QFM1 | 88-677 | None |
| A0A835V1B1 | 2-535 | None |
| C3Z3R9 | 20-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.