DPCstruct | MC33930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 101 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Q4SHZ6 | 3-87 | YLAVVLDGPKAKNGRKVFESFVQQNRQMFWNRELTAACESLAYMGFMRPGTLFISGPQQQLAVLKDAWARRILKAAMGYTITSLG |
| A0A0K0DEQ0 | 2-87 | SCLAITFSGPKTRNGRRLFENFVQANKFSFWNRELVLAVESLIFMGFMRPCTIFVSGSVTHLQSLRTAWARRVLKPAEGYLISSLG |
| A0A4C1T7F7 | 66-132 | None |
| A0A3Q0KG27 | 7-100 | None |
| A0A2T7PWU2 | 94-161 | None |
| A0A482WZV2 | 7-77 | None |
| A0A7E5WGF3 | 14-112 | None |
| H3B8G4 | 7-109 | None |
| A0A3S0ZZD8 | 10-151 | None |
| A0A2Y9SBE0 | 115-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.