DPCstruct | MC3393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 186 ± 22 aa |
| Standard deviation of domain lengths | 22.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814FMU8 | 9-196 | PALPLHTEKFRGKRQFGTDVLINNWFEDRSKYKESSYLHNTTYRIDYPGHPDARPDTVLRRKLLLAQQERPAKLLTGHHDIDDRKNL… |
| U3J4Z4 | 5-191 | YGRDWWKIEPKYSTRVLIGNWLEERKRFIKPTGKLGHSIYSTDFVCFPDHKPEQTVRRTMRKKYEGLPAQHFFTHHEEPRSRNLVSE… |
| A0A7R9CNF4 | 6-203 | None |
| A0A310SRD3 | 31-244 | None |
| A0A7I8VJN4 | 15-209 | None |
| A0A819I869 | 32-217 | None |
| A0A821GT22 | 20-173 | None |
| A0A6G0YJ15 | 9-149 | None |
| F1P4Y1 | 45-252 | None |
| K1Q6B9 | 2-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.